PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010536333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TALE
Protein Properties Length: 523aa    MW: 59319.2 Da    PI: 7.1843
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010536333.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.7e-103774141954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gLt++qV +WF N R +
  XP_010536333.1 377 FEHflHPYPKESEKIMLAKQTGLTKSQVANWFINARVR 414
                     665559******************************88 PP

2BELL120.29.3e-39240311172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er++lq kk+kLls+++eVd+rY+qy++q+++v+ssFe+vaglg+akpYts+Al++iS hFrcL+d i +qi
  XP_010536333.1 240 ERHDLQDKKTKLLSMVDEVDRRYNQYYHQMEAVASSFEMVAGLGAAKPYTSVALNRISCHFRCLRDSIRGQI 311
                     799******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.9E-55167309IPR006563POX domain
PfamPF075267.2E-47174307IPR006563POX domain
PROSITE profilePS5007112.39355418IPR001356Homeobox domain
SMARTSM003891.6E-10358422IPR001356Homeobox domain
CDDcd000861.62E-12358419No hitNo description
SuperFamilySSF466898.13E-18359425IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-29361424IPR009057Homeodomain-like
PfamPF059207.8E-18375414IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MAVYYPSTVT CNRDGMQSLY QEPLYLNQQQ ASSSSAGSFS TIVAGGGNCL EIPHAGVRNE  60
MVFIPPTGEV TALQGLNANA VSSSDLSFHG QGLSLTLGTQ IPNAVAVPAF QYQYPNMSNQ  120
LSFGPSHSIP VKETLSCKSR EMLGQSEQIP SSGFNLEFYN GYRCDSSGFM GSVMCSRYLK  180
PAQQLLDEVV NLRKDLKQVN KNSNNNKGQD FNGFSDYKDT ENGSNVSESN GKPLQLSPLE  240
RHDLQDKKTK LLSMVDEVDR RYNQYYHQME AVASSFEMVA GLGAAKPYTS VALNRISCHF  300
RCLRDSIRGQ IQIIRGKLGE KDSSEEKEER IPRLRYLDQR LRQQRALHQQ LGMVRPAWRP  360
QRGLPENAVS ILRAWLFEHF LHPYPKESEK IMLAKQTGLT KSQVANWFIN ARVRLWKPMI  420
EDMYKEEFGD SELNPKFCQE NNADSSHTTD SQSQQRINNN KNSKNNISYS YADTNTVFTD  480
PKQDESQQMN RSVEYETLTN YHGFNLDDYN RFSNPHHLHD FVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-17364421158Homeobox protein Meis1
4xrs_A4e-17364421158Homeobox protein Meis1
3k2a_B6e-17364421562Homeobox protein Meis2
3k2a_A6e-17364421562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010536333.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-180BEL1-like homeodomain 3